PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00045209001
Common NameGSBRNA2T00045209001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 392aa    MW: 43624.5 Da    PI: 8.411
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00045209001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.63.5e-18320354135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C++C ttkTp+WR+gp g+ktLCnaCG+++r+ +l
  GSBRNA2T00045209001 320 CTHCETTKTPQWREGPCGPKTLCNACGVRFRSGRL 354
                          *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.9E-16314364IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.52E-14318377No hitNo description
Gene3DG3DSA:3.30.50.104.7E-14318351IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.49318350IPR000679Zinc finger, GATA-type
PfamPF003205.7E-16320354IPR000679Zinc finger, GATA-type
CDDcd002021.13E-13320356No hitNo description
PROSITE patternPS003440320345IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MGLFLVRFGY FLSFFLFFFS SFLSSYNCQF WSEVTMSKIK MKSVKFNFLP KKKVKKKPTE  60
NSGMHDRILT LLSPSLHSFL SSVIPKPPNS NNFRFSLSLS LSLCLGNAFC VVSSCNASGC  120
GQMNNGGSWL PEEEEELKGL SENFFDDLIT LPLEEDLETG DDDEEGDWDA KFENLVPPPL  180
DLLTSLSSEF SHAPRAGLLR NPLPTLKQSS SSEVSSSSLP DVKLSTLFQS SSALSVAANG  240
SVSFPVKGTR SNLRKRPTPP TFRSLKSFAS EMVQQFAPDD PDSETYLPFA KKKRQRKNKD  300
QSSVSDSPEQ FNADGTIRMC THCETTKTPQ WREGPCGPKT LCNACGVRFR SGRLLPEYRP  360
SSSPSFIPSL HSNSHRKIIE MRRKDQDLQP G*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1290295KKKRQR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.278300.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00045209001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009140896.11e-175PREDICTED: GATA transcription factor 11-like isoform X2
SwissprotQ6DBP81e-79GAT11_ARATH; GATA transcription factor 11
TrEMBLA0A078GZC20.0A0A078GZC2_BRANA; BnaA04g16390D protein
STRINGBra035708.1-P1e-170(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-49GATA transcription factor 11
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]